Top 17 Outdoor Driveway Lights

 

1. JACKYLED

12-Pack Upgraded Solar Driveway Light Dock Lights JACKYLED IP68 Waterproof LED Deck Lighting Outdoor Aluminium Warning Road Markers with Switch for Pathway Lake Boat Dock Flat Step Yard, Warm White

Sturdy durable with an aluminum alloy casing the solar dock lights can withstand 25 tons of pressure which have passed the professional compression test It will not be damaged even the trucks passing through Durable and ideal for outdoor lighting Ip68 waterproof ip68 the highest grade of dustresistant and waterresistant Please be assured to use it outdoors without worrying about any bad weather Onoff switch the upgraded switch control can avoid battery loss caused by too long storage time Works out of the box experience our dock lights for the first time without waiting for the product to absorb sunlight

Longlasting illumination equipped with a 600mah battery our solar deck lights can be continuously illuminated for up to 72 hours when fully charged It turns on automatically at night and illuminates from dusk to dawn No longer worry that the solar marker lights will dim or go out at midnight Soft warm lighting builtin 6pcs highquality bright led light beads our solar driveway lights provide soft warm light for your dock deck swimming pool porch step stairs walkway garden yard etc Protect you and your families from the falling accident caused by the darkness of night

Upgraded solar panel with the newest solar panels the charging efficiency of our solar dock lights has been greatly improved and the charging time is shorter only 4 hours in full sunlight

 

2. GIGALUMI

GIGALUMI Solar Pathway Lights Outdoor, 12 Pack Solar Lights Outdoor,Solar Garden Lights,Solar Walkway Lights for Garden, Landscape, Path, Yard, Patio, Driveway

Easy to installyou dont need wiring to get these lights installed because theyre completely wireless These outdoor waterproof solar garden lights can be installed in just a couple steps and be ready to light up the night in no time Perfect outdoor decorationthe led pathway lights here have a unique house design that offers a great amount of style for your landscape Great for your garden yard flower bed terrace walkway driveway or anywhere else they are sure to light up your space Ip44 waterproofyou need outdoor solar lights that are high quality and built to last and thats exactly what these are Theyre made with highresistance abs plastic and theyre fully weather and impactresistant They also have an ip44 waterproof rating that makes sure theyre safe to use even in severe weather on rainy days or even in the snow

Energy savingthe solar garden lights are powered by the sun They automatically charge during the day over a period of 68 hours Then they turn on automatically at night providing you with 810 hours of lighting

Perfect servicewith these outdoor solar landscape lights youre going to not only have your expectations met but exceeded If not just contact us and well take care of whatever you need right away

 

3. Lacoco

Solar Pathway Lights 8 Pack Solar Lights Outdoor Decorative IP65 Waterproof Auto On/Off Landscape Lighting for Yard Patio Walkway Driveway Pathway Path Sidewalk Lawn

Easy installation solar lights outdoor decorativeno wires the garden lights solar powered are easy to install in just seconds The solar walkway lights can be installed without connecting wires or power grids If the soil in your garden is quite solid we recommend that youd better dig a hole on the ground before inserting the stake Auto onoff solar landscape lightssolar landscape lights will switch on and off automatically It will automatically turn on the lighting in dark environment and automatically turn off in bright environment Solar yard lights warm is beautiful and a perfect addition to your backyard

Allweatherresistant ip65 waterproofthe solar pathway lights with a high waterproof ip65 It is suitable for outdoor use without worry the damage of bad weather such as rain and snow Corrosion resistant abs plastic can ensure long lasting life and durability of this outdoor lights solar powered The bright light given off by this solar power walkway light can stay lit and light up your way to home when no light source is available

Aftersale service warranty solar walkway lights outdoor100 satisfaction guarantee and friendly customer service within a 24hour support Any questions with these solar pathway lights contact usyou will get 90 days free return 3 year free replacement warranty Please be assured that your satisfaction and recognition is our top priority

Dusk to dawn solar pathway lightsoutdoor pathway lights are equipped with a 2v 600ma nimh battery It only needs 68 hours to be fully charged and provides 8 hours of working time to meet the night lighting needs Solar pathway lights will absorb sunlight during the day meanwhile automatically turn on at night and turn off at dawn to ensure lighting throughout the whole night The pattern of this decorative solar lights outdoor is also attractive

Wide application solar lights outdoor decorationyou can install these solar lights outdoor in any place without concerns about the power supply just make sure the lamp can absorb sunlight You can use solar outdoor lights everywhere like garden lawn walkway pathway patio or yard etc The soft warm light can help create a perfect atmosphere when you take a walk with your family friends and so on

 

4. XMCOSY+

XMCOSY+ Solar Pathway Lights – 4 Pack Solar Lights Outdoor Garden, Solar Path Lights IP65 Waterproof Auto On/Off, 10-40 Lm Dimmable Warm White Solar Walkway Lights for Driveway, Yard, Lawn, Landscape

Brightly adjustable warm white led filament there is a knobtype brightness adjustment on the switch panel and the brightness can be adjusted to a range of 1040 lumens The most suitable brightness can be selected flexibly according to different user requirements and usage environments Autoonoff switch sensing saves more energy 24 24 inches largearea solar panels covered with monocrystalline silicon Increase the range of solar illumination to ensure more solar energy absorption and utilization Automatically sense changes in the brightness of the surrounding environment It automatically turns on the lighting in dark environments and automatically turns off in bright environments Dont worry about the wasting of resources

Waterproof dustproof strong sturdy material the main components of the lamp are made of stainless steel and plexiglas to ensure durability and are not easily damaged The perfect sealing design and ip65 waterproof level can better cope with various complex outdoor environments No worry about the battery will short circuit in rainy weather and the led filament will be polluted by dust and cause insufficient illumination Absolutely can be used in any complex outdoor environment

Ecofriendly solar powered 360 illumination all working energy comes from solar energy and recycled energy reduces environmental pollution and without having to increase your electricity bills Guarantee to continue working for a whole night The long strip of led filament with a polyhedral transparent glass shade gives a 360 radial light effect Excellent combination of product decoration and practicality

Easy to install within only three components simply connect the solar lid mounting rod ground spike to complete the installation and get started Eliminate cumbersome and complicated installation operations Unlike ordinary plastic plugs our solar powered walkway lights use aluminum pointed plugs that are rigid and durable enough It can be placed everywhere like your garden path patio lawn pathway driveway front yard villa landscape balcony and outdoor places

 

5. SUNVIE

SUNVIE Low Voltage Landscape Lights with Wire Connectors 12W LED Well Lights IP67 Waterproof Outdoor In-Ground Lights 12V-24V Warm White Pathway Garden Lights for Driveway Deck (10 Pack & Connectors)

Safe and easy to use1224v working voltage compatible with most low voltage landscape lighting transformers Including 20 unique sunvie screw tight designed fastlock connectors Easier and safer to install energy saving Transformer required to change 110v to 12v or 24v transformer not included Upgraded 12w ultra bright10 pack 1200lm 3000k warm white led well lights ultra bright Perfect for lowvoltage landscape lighting of pathway garden landscape hardscape plant driveway deck pool yard patio etc

Premium grade componentspremium stainless steel cover and screws impactresistant hightemperature tempered soda lime glass and highquality led chips Our outdoor ground lights have a service life of up to 50000 hours Upgraded ip67 waterproofwater tight seals pressure rubber gasket rubber seal around wire exit Sunvie ip67 waterproof garden lights perfectly illuminate your house fence backyard gardenway other outdoor decorations

Lifetime warranty30day moneyback guarantee 24month replacement warranty and lifetime aftersales support guarantee Buy with confidence

 

6. VOLISUN

VOLISUN Solar Driveway Lights Dock Deck Lights 8-Pack,2 Colors in 1,Wireless Solar Powered 1200mAh Battery,Waterproof Outdoor Warning Step Lights for Driveway Sidewalk(2 Colors Lighting,White/Blue)

Highest industry standardsvolisuns has a complete design and production team for solar deck lights and has passed fcc highstandard certification Customer satisfaction is our purpose any product questions please contact volisun customer service 24h reply Two colorswitchable 2 colors in 1 whiteblue switch the lighting color by flipping the bottom switchno need to worry about what color lighting to provide for your driveway Builtin 12 led beadswhich gives out intensityt and steady light for your driveway dock deck and sidewalkpractical decorative

Solar poweredbuiltin 1200mah large storage batteryauto solar powered during daytime and glows when night falls68 hours solar charging timesolar deck lights enough to supply the leds up to 10 daysWidely used for dock deck driveway pathgardenstep stairs etc

Installs in minutesoutoftheboxno wiring this solar lights can be installed in any place where the sunshine Fix it with screws or glue two installation methods 8pcs screws and doublesided tape included in the package

Waterproof resistance to pressurevolisun solar dock lights use antirust cast aluminium shell which can bear pressure of 20 tons after testing ip67 waterproof rating means that solar driveway lights will not be damaged even if immersed in waterNot afraid of the crushing of large trucks or boatdesigned for your driveway and dock

 

7. JSOT

JSOT Solar Garden Lights, 150LM Bright Solar Pathway Lights Outdoor Waterproof, Landscape Path Lights for Backyard Walkway Driveway Lawn Yard Decor Lighting, Cool White/Warm White, 4 Pack

Longer lighting time autoonoff the yard lights select the newest solar panel which is up to an 18 conversion rate and the charging speed is faster than other solar lights Pathway lights is equipped with a 750mah aaa batteries can store more power than other solar lights Lighting time up to 810 hours after 68 hours full charged under direct sunlight They automatically turn on at night and turn off at dawn by sensitively detecting the lightness of the surroundings 2 lighting modes 2 installation heightjsot solar pathway lights with 2 lighting mode Turn on the lights and it defaults to mode 1cool white press the button again it will into mode 2warm white The solar garden lights comes with 2 inserting poles You can choose to use 1 light pole or 2 light poles to insert the solar light into the ground which greatly meets your installation height requirements for different application scenarios in outside backyard and garden

best quality servicejsot offer 30 days free return and 365 days free replace So any question about solar pathway lights please do not hesitate to contact us through amazon order detail page order sold by contact seller Tips most solar lights outdoor garden take an average of 8 hours to fully charge so please make sure nothing shades your solar lawn lights and expose them to full sun for 8 hours before starting installation

Ip65 waterproof wireless design solar landscape lights are made of highimpact abs material durable construction Ip65 waterproof specially designed to withstand all kinds of weather all round the year which avoid longterm outdoor exposure under extreme weather and causing cracking or deformation No worries about rain snow frost or high temperature

Wide application garden solar lights unique appearance design solar yard lights like a golf clubs the light pattern is also attractive Install landscape path lights along the pathway not only makes your garden bright and beautiful but also light up your way at night It is perfect for garden pathway walkway backyard driveway lawn yard patio camping lighting The solar lights can be used to decorate your garden at the festival like halloween christmas thanksgiving day etc

 

8. Linkind

Linkind 12 LEDs Landscape Solar Spotlights, 350LM, 6500K Daylight White, 2-in-1 Outdoor Solar Powered Garden Lights, Dusk-to-Dawn IP67 Waterproof for Garden Yard Patio Driveway Porch, 6-Pack

Two lighting modes daylight white features a large capacity lithium battery and up to 20 photoelectric conversion rate the solar spotlights runs 12hrs at low light mode6 hrs at high light mode on a full charge Press the button to get a sequence of lowhighoff It is auto on at night and auto off at sunrise Twoway mounting with specially designed ground stake and wall bracket you can either stick it into the ground as landscape light or fix it on the wall as wall light Be creative to arrange the position which you want to be Perfect for patio porch deck pool yard garden garage driveway pathway etc

Fully adjustablefocused the head of the spotlight is adjustable 180 degree horizontally and 90 degree vertically making it easy to get as much exposure in the sun and direct the light to areas where it is needed The 90 degree beam angle means more focused and brighter spots to highlight the ideal outdoor features compared to the 120 flood light in the market

Small size excellent performance compact and spacesaving not obtrusive to be integrated with the landscape The small size doesnt sacrifice any in brightness The 12 leds landscape spotlights is able to shine at 350lm brighter than many in the market super bright to illuminate the tree wall post etc It aims at

Waterproof durable the ip67 waterproof design protects the solar lights from all kinds of bad weather Enjoy a hasslefree landscape lighting after it is installed The wellmade structure and high strength abs material ensure a long lifespan Ce fcc certified

 

9. Vont

Vont LED Outdoor Solar Lights, [2 Pack] IPX7 Waterproof Landscape Spotlights, Garden Lights, Wireless Solar Powered Outdoor Lights/Lighting for Yard, Walkway, Driveway, Porch, Patio (Cool White)

Upgraded for 2022 add life to your trees and enjoy a satisfying light show at night With super bright 16 leds throwing a 120 lighting angle it will illuminate your whole backyard The solar panels are adjustable durable and look more handsome than other 46 led lights in the market Your landscape will simply look spectacular at nighttime Instant installation w no tools set up is fast easy to use Stick into the grass with stakes and use it as a solar landscape spotlight Or mount on the wall with the screws included and aim at a tree as a solarpowered wall light See every part of your yard even your dogs chasing a gang of raccoons Light up your garden driveway patio pool front doors walls garage etc

Lifetime warranty covered for life its warranted against loss theft and defects in materials and workmanship as long as you own the product Or as long as youre alive so you can rest in knowing that this product has the quality that you are looking for Certified by ce fcc rohs msds un383

2 brightness modes choose between low mode 12 hours and high mode 6 hours Your lights know when its dark and can easily detect changes in outdoor brightness Automatically switches from energy storage to lighting mode without motion detection Doubles as a flashlight in a pinch Auto on at night and auto off at sunrise

Ipx7 water heatproof our outdoor solar spotlights are made of highimpact abs material with an ipx7 wireless waterproof design Meaning it can withstand rain and other extreme weather conditions And its much more robust than other less waterproof grade lights

 

10. Suponar

Solar Lamp Post Light with Planter, Solar Post Lights Outdoor Waterproof , Street Lamp Pole Lighting Outside for Yard Driveway Garden Patio Decoration, 64Inch

Low maintenance64 solar post lights requires little to no maintenance Any issues about the suponar solar lamp post light outdoor with planter please contact us anytime If you were finding solar lamp post light now what are you waiting for Outdoor decoration the solar post lights outdoor cleverly combines solar lamp and plantercomposed of two parts together very well You can plant your favorite flowers in planter then place post lamp on streetdriveway patio garden yard to add beautiful outside decorations 50lumens warm white light provides a bright welcoming glow to your house weather resistant the solar pole light is made of sturdy plastic Ip45 waterproof standard and heat resistance ensure it can withstand sunny rainy and snowy days You dont need to worry about bad weather anymore But before the strong wind please move the planter to safe place to prevent it from being blown over

Easy installation solar street lamp do not need wiresInstallation is simple and only takes a few minutes to assemble Confirm the parts before installation and complete the assembly step by step according to the instructions Please place light post in direct sunlight

Solar powered suponar solar lamp post light has four highefficiency solar panels that convert more sunlight to charge high capacity battery Make sure solar pole light outdoor lighting works longer The light sensor is built in the lamp can light at dusk charge daytime automaticallyNot only save your electirc billbut also providing convenience

 

11. Sengled

Sengled Motion Sensor Flood Lights Outdoor Dusk to Dawn Security Light Bulbs, E26 PAR38 Motion Activated 5000K Daylight, 1050LM, Waterproof LED Light Bulbs for Porch, Driveways, 2 Pack 4rd Gen

Highquality motion sensor equipped with a superior motion sensor sengled par38 motion detector lights for outside features high sensitive 100 detection angle and 23ft detection distance Even a cat passing by can trigger the light on in dark conditions 5000k daylight super bright outdoor motion sensor light gives off a bright amount of bluewhite light 5000 kelvin similar to the daylight best for porch garage driveways and work environments where bright illumination is needed

Durable and energy saving waterproof rating ensures our motion sensor outdoor light against harsh weather conditions Energy and costs saving by replacing your 100w halogen fixture with our 1050lm led motion sensor flood light save more than 85 electricity bill per year Reliable quality sengled motion activated light meets all required certifications ensuring superior quality and safe operationEasy to install and transform your existing lights into motionactivated lights without extra hardware or expense Our usbased team will offer you technical support and customer service whenever you need it

Auto onoff always on mode motion sensor light bulbs builtin photocell sensor which enables the bulb to stay off during the day and automatically light up when movement is detected at night Or by quickly flipping the power switch off and back on within one second you can turn the motion detection mode to always on mode This enables the led bulb to stay on in dark environments just like an ordinary bulb regardless of whether the movement is detected More convenient and practical for both indooroutdoor use

 

12. ZUCKEO

Low Voltage Landscape Lights ZUCKEO LED Well Lights 3W 12V-24V in Ground Lights IP67 Waterproof Low Voltage Landscape Lighting Flood Driveway Deck Step Garden Lights Outdoor (8 Pack Warm White)

Waterproofwater tight seals pressure rubber gasket rubber seal around wire exit Ip67 waterproof deck lights perfect for outdoor garden pathway lighting Premium grade componentsthe convex lens are clear make these buried landscape lights appear brighter than the typical one High temperature tempered sodalime glass for highimpact resistance High quality led light chip lifetime up to 30000 hours Widely used for indoor deck outdoor landscape decoration90 beam angle beautify your garden easily great decoration for indoor outdoor decks fences steps path walls trees

Upgrated voltage12v or 24v working voltage campatble with most low voltage landscape lighting transformer Easier and safer to install energy saving Transformer required to change 110v to 12v or 24v transformer not included Lifetime warranty30day money back guarantee 24 month replacement warranty and lifetime aftersale support guarantee

 

13. SOLPEX

Solpex 16 Pack Solar Lights Outdoor Pathway ,Solar Walkway Lights Outdoor,Garden Led Lights for Landscape/ Patio/Lawn/Yard/Driveway-Cold White (Stainless Steel)

Energy savingno need wiringSolar garden lights are powered by the sun providing them with 68 hours of sunlight which can bring you 810 hours of lighting at night without wasting any energy or electricity Weatherproof solar garden lights are made of stainless steel They are very durable and dont have to worry about bad weather Including rainy nights and small snowy days Perfect serviceif you have any questions about our solar lights please contact us actively we will give you a satisfactory reply

Easy to installremove the isolator tab under the cap and push the stake into the soil The solar path lights automatically turn on at night and turn off at dawn Elegant designsolar outdoor lights is suitable for any pathway Decorate your driveway walkway garden path deckyard or any other outdoor spot to light up the night

 

14. APONUO

Solar Dock Light Driveway Lights Outdoor， APONUO Solar Deck Lights 8packs Pathway Lights Led Step Waterproof Outdoor Warning Step Lights for Driveway Garden Pathway Step (White) (Blue)

Aponuo driveway light emitted is bule and visible at more than 875 yards shines up and down allowing for a highvisibility to light up the sides of the driveway Upgraded switch control avoid the situation that battery loss caused by being placed for too long 2 years warranty ensures this will become your norisk purchase Builtin 600mah large capacity battery and monocrystalline silicon solar panel up to 17 solar energy conversion efficiency it can turn on 72 hours after charging for 4 hours

This gives you the freedom to installed in any ground where it can absorb the sun light Bright enough to illuminates the driveway or dock at night neighbors will envying Heavy metal tells you its quality which means that will not be damaged even the car run over Ip68 dust and water resistance makes them survived the snow and rain

 

15. VOLISUN

Solar Deck Lights Driveway Dock Lights, VOLISUN 12-Pack Led Wireless IP67 Waterproof Outdoor Warning Step Lights for Driveway Sidewalk Garden Pathway Yard(White)

Waterproof resistance to pressureip67 rating allows for downpours and submersion High quality heavy metal frame bear 50 weight than other lights which means that it will not be damaged even the car or truck run over it Long lighting timebuiltin 600mah large storage battery 68 hours solar charging time when in good sunshine condition enough to supply the leds up to 5 days Highest industry standardsthe whole volisuns solar dock lights are certified by fcc of a high standard Different from other brands of manufacturing materials Our single led lights have a net weight of 065lb high quality assurance For any product questionsplease contact volisun customer service

Installs in minutesthis light can be quickly installed in any ground where it can absorb the sun light directly No wiring you can fix it with screws or glue 12pcs screws included in the packagejust like the jp2023a screw the screws are more in line with the usage habits

Solar poweredecofriendly rechargeable solar panelsautomatically recharges during the day and glows when night fallsEach light has 6 leds which gives out intensityt and steady lightWe could have called these deck dots stair dots pier dots or boardwalk dots

 

16. JSOT

JSOT Solar Outdoor Lights,IP65 Waterproof Solar Pathway Path Lights Decorative for Garden Path Walkway Yard Driveway Holiday Decoration Landscape Lighting In-Ground Lights 4 Pack

save energy and timefree sunlights provides powerful energy to charging ground solar lightsgreatly guarantee the power supply glow at nightThroughout the nightYou have no extra electricity feeWith no wiring necessary these solar led pathway lights are practically maintenance free that save your timeYou dont need charging by yourself and just enjoy safety and ambiance of night illuminating 365 days worryfree guarantee notes we provide perfect aftersales serviceincluded 365 days free guarantee and technical supportIf any questions please feel free to contact with uswe will give you a satisfied solutionPlease notes 1we can not get in touch with you via product comment2if temperature is below 65fthe lighting time will be shorter than in summerapproximately 24 hoursthe higher of the suns temperature the longer the working time

Modern beauty appearance design ip 65 waterproof12 led beads driveway path solar lights boast a crisp black finish and decorative transparent diamond trim lensresulting in a lovely modern look and it takes on the elements with its waterresistant constructionnot only can lighting your outdoor place in any weatherbut while adding to the beauty of your yard and garden360 degrees horizontal rotationgreat meet your need of the different lighting position

2 lighting color modes 2 install wayhigh power solar path lights with 2 lighting color modes cool white warm whiteTurn on the light and it is defaulted to mode 1cool whitepress button again will into mode 2warm whiteThe solar landscape lighting come with installation accessories can insert the ground or mounting on the wallSolar path lights very fit for your different need of lighting and decorationLike halloweenchristmasthanksgiving day decor

Automatically work at day nightsolar garden lights outdoor build in light sensor to turns the light on at duskturn off at dawnas well as auto charging from sunshine for ultimate convenienceOutdoor solar spotlights are great for lighting your drivewayswalkwayssidewalkslawngardenpatioporchpath deckpoolyardgardengarage etc

 

17. LETMY

LETMY Solar Pathway Lights Outdoor, 8 Pack Bright Solar Lights Outdoor, IP65 Waterproof Auto On/Off Solar Garden Lights Solar Powered Landscape Lighting for Yard Patio Walkway Driveway Pathway

Aftersale service we provide 60 days replacement or riskfree refund warranty for our garden lights solar powered If you have any questions about our landscape path lights please contact us immediately and we will do our best to solve your problem Please be assured that your satisfaction and recognition is our top priority Bright long lasting this 8 pack outdoor solar lights adapt upgraded filament led which creates a romantic and warm atmosphere and brighter than other solar lights This solar pathway lights are equipped with upgraded solar panel rechargeable nimh battery 300mah  Solar garden lights can light up to 8 12 hours and provide clear illumination brightness

Wide application easy to install you can use solar outdoor lights everywhere like garden lawn walkway pathway patio or yard etc The soft warm light can help create a perfect atmosphere when you take a walk with your family friends and so on No addition tools required to install this solar outdoor lights Quickly install this solar garden lights by pushing this solar landscape light outdoor into the ground

Auto onoff energy saving warm decor solar landscape lights will switch on and off automatically It will automatically turn on the lighting in dark environment and automatically turn off in bright environment The led solar landscape lighting will save your time and electricity bills The pattern of this decorative solar lights outdoor is also attractive solar yard lights warm is beautiful and a perfect addition to your backyard

Allweatherresistant light up your way the solar pathway lights with a high waterproof level ip65 Dont worry about rain snow frost or sleet Corrosion resistant abs plastic can ensure long lasting life and durability of this outdoor lights solar powered The bright light given off by this solar power walkway light can light up your way home when no light source is available

We are a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for us to earn fees by linking to Amazon.com and affiliated sites.